S100A10 Antibody
Product Sizes
100 ul
£ POA
LS-C749651-100UL
20 ul
£ POA
LS-C749651-20UL
About this Product
- SKU:
- LS-C749651
- Additional Names:
- S100A10, 42C, ANX2LG, Calpactin-1 light chain, Calpactin I light chain, CLP11, p11, p10, p10 protein, Protein S100-A10, ANX2L, Ca[1], CAL1L, Cellular ligand of annexin II, gp11
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Concentration:
- 0.47 mg/ml
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human S100A10 (NP_002957.1). MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Non-human Primate, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:775248
