TM7SF4 / DC-STAMP Antibody
Product Sizes
100 ul
£ POA
LS-C749624-100UL
20 ul
£ POA
LS-C749624-20UL
About this Product
- SKU:
- LS-C749624
- Additional Names:
- DCSTAMP, DC-STAMP, HDC-STAMP, IL-Four (IL-4) induced, IL-four-induced protein, IL-4-induced protein, IL-Four INDuced, TM7SF4, FIND
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Concentration:
- 1.71 mg/ml
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 401-470 of human DCSTAMP (NP_110415.1). KILVSASFYPSVERKRIQYLHAKLLKKRSKQPLGEVKRRLSLYLTKIHFWLPVLKMIRKKQMDMASADKS
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:775221
