GLP1R / GLP-1 Receptor Antibody
Product Sizes
100 ul
£ POA
LS-C749005-100UL
20 ul
£ POA
LS-C749005-20UL
About this Product
- SKU:
- LS-C749005
- Additional Names:
- GLP1R, GLP-1-R, GLP-1 receptor, GLP-1R, GLP-I receptor, Glp1 receptor
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 22-116 of human GLP1R (NP_002053.3). GPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNS
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:774602
