C10orf2 / PEO1 Antibody
Product Sizes
100 ul
£ POA
LS-C748482-100UL
20 ul
£ POA
LS-C748482-20UL
About this Product
- SKU:
- LS-C748482
- Additional Names:
- C10orf2, Ataxin 8, IOSCA, Mitochondrial twinkle protein, PEO1, PEO, SANDO, SCA8, Twinkle protein, mitochondrial, MTDPS7, PEOA3, TWINKLE, TWINL
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 600 to the C-Terminus of human C10orf2 (NP_068602.2). KRYLQVSKNRFDGDVGVFPLEFNKNSLTFSIPPKNKARLKKIKDDTGPVAKKPSSGKKGATTQNSEICSGQAPTPDQPDTSKRSK
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:774079
