SCD5 / SCD4 Antibody
Product Sizes
100 ul
£ POA
LS-C748188-100UL
20 ul
£ POA
LS-C748188-20UL
About this Product
- SKU:
- LS-C748188
- Additional Names:
- SCD5, ACOD4, Acyl-CoA-desaturase 4, FADS4, Stearoyl-CoA desaturase 5, Stearoyl-CoA 9-desaturase, SCD4, HSCD5, SCD2, Stearoyl-CoA desaturase 4
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human SCD5 (NP_001032671.2). MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGAVYSLVLIPKAKPLTL
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:773785
