A1CF / ACF Antibody
Product Sizes
100 ul
£ POA
LS-C748148-100UL
20 ul
£ POA
LS-C748148-20UL
About this Product
- SKU:
- LS-C748148
- Additional Names:
- A1CF, ACF65, ACF64, APOBEC-1 stimulating protein, APOBEC1 complementation factor, APOBEC1CF, ACF, Apo-B RNA editing protein, APOBEC1-stimulating protein, RP11-564C4.2, ASP
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 50-120 of human A1CF (NP_055391.2). APPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYE
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:773745
