CLU / Clusterin Antibody
Product Sizes
100 ul
£ POA
LS-C747981-100UL
20 ul
£ POA
LS-C747981-20UL
About this Product
- SKU:
- LS-C747981
- Additional Names:
- CLU, APO-J, Apolipoprotein J, CLU1, Clusterin, Complement lysis inhibitor, CLI, AAG4, Aging-associated protein 4, Ku70-binding protein 1, KUB1, SGP2, APOJ, SGP-2, Sulfated glycoprotein 2, CLU2, Complement cytolysis inhibitor, NA1/NA2, SP-40
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human CLU (NP_001822.3). DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQT
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:773578
