SULT1A2 / Sulfotransferase 1A2 Antibody
Product Sizes
100 ul
£ POA
LS-C747923-100UL
20 ul
£ POA
LS-C747923-20UL
About this Product
- SKU:
- LS-C747923
- Additional Names:
- SULT1A2, Aryl sulfotransferase 2, Arylamine sulfotransferase, P-PST 2, P-PST, STP2, TSPST2, Phenol sulfotransferase 2, ST1A2, HAST4, Sulfotransferase 1A2
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 201-295 of human SULT1A2 (NP_001045.1). KREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:773520
