SLC1A5 / ASCT2 Antibody
Product Sizes
100 ul
£ POA
LS-C747767-100UL
20 ul
£ POA
LS-C747767-20UL
About this Product
- SKU:
- LS-C747767
- Additional Names:
- SLC1A5, ATBO, ASCT2, ATB0, Baboon M7 virus receptor, AAAT, M7VS1, M7V1, R16, RDRC, RD114 virus receptor, RDR, ATB(0)
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC1A5 (NP_005619.1). MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGLGVSGAGGALALGPERLSAFVFPGELLLRLL
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:773364
