PSMD10 / Gankyrin Antibody
Product Sizes
100 ul
£ POA
LS-C747573-100UL
20 ul
£ POA
LS-C747573-20UL
About this Product
- SKU:
- LS-C747573
- Additional Names:
- PSMD10, 26s proteasome subunit 10, Ankyrin repeat protein, DJ889N15.2, Gankyrin, p28, p28(GANK)
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 127-226 of human PSMD10 (NP_002805.1). EGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:773170
