BAF60B / SMARCD2 Antibody
Product Sizes
100 ul
£ POA
LS-C747290-100UL
20 ul
£ POA
LS-C747290-20UL
About this Product
- SKU:
- LS-C747290
- Additional Names:
- SMARCD2, BAF60B, BRG1-associated factor 60B, CRACD2, PRO2451, Rsc6p, Swp73-like protein, Swi/snf complex 60 kda subunit
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 454-531 of human SMARCD2 (NP_001091896.1). RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:772887
