CCL26 / Eotaxin 3 Antibody
Product Sizes
100 ul
£ POA
LS-C747212-100UL
20 ul
£ POA
LS-C747212-20UL
About this Product
- SKU:
- LS-C747212
- Additional Names:
- CCL26, CC chemokine IMAC, Ccl26, Ccl26l, C-C motif chemokine 26, Chemokine N1, Eotaxin-3, Eotaxin 3, Eoxtaxin-3, MIP-4-alpha, IMAC, SCYA26, Small inducible cytokine A26, Thymic stroma chemokine-1, MIP-4alpha, TSC-1, Small-inducible cytokine A26, Eotaxin3, MIP-4a
- Application:
- Immunofluorescence
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 24-94 of human CCL26 (NP_006063.1). TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:772809
