AKAP7 Antibody
Product Sizes
100 ul
£ POA
LS-C747106-100UL
20 ul
£ POA
LS-C747106-20UL
About this Product
- SKU:
- LS-C747106
- Additional Names:
- AKAP7, A-kinase anchor protein 9 kDa, A-kinase anchor protein 18 kDa, AKAP-7 isoforms alpha and beta, AKAP-7 isoform gamma, AKAP 18, AKAP15, AKAP18, PRKA7 isoform gamma, PRKA7 isoforms alpha/beta
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human AKAP7 (NP_004833.1). MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:772703
