CXCR3 Antibody
Product Sizes
100 ul
£ POA
LS-C747020-100UL
20 ul
£ POA
LS-C747020-20UL
About this Product
- SKU:
- LS-C747020
- Additional Names:
- CXCR3, C-x-c chemokine receptor 3, CD183 antigen, CKR-L2, CXCR-3, CMKAR3, CD182, CD183, Cxcr3a, GPR9, IP-10 receptor, IP10-R, Mig receptor, MigR, Mig-R, Chemokine (C-X-C) receptor 3, CXC-R3, Cxcr3b, G protein-coupled receptor 9, IP10 receptor
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 289-368 of human CXCR3 (NP_001495.1). NCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSETSEASYSGL
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:772617
