IL-1B / IL-1 Beta Antibody
Product Sizes
100 ul
£ POA
LS-C746953-100UL
20 ul
£ POA
LS-C746953-20UL
About this Product
- SKU:
- LS-C746953
- Additional Names:
- IL1B, IL-1B, IL-1 beta, IL1-BETA, Preinterleukin 1 beta, Pro-interleukin-1-beta, Catabolin, IL-1, IL1F2, Interleukin 1, beta, Interleukin-1 beta
- Application:
- Immunofluorescence, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 124-223 of human IL1B (NP_000567.1). CTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEIN
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:772550
