H2AFX / H2AX Antibody
Product Sizes
100 ul
£ POA
LS-C746951-100UL
20 ul
£ POA
LS-C746951-20UL
About this Product
- SKU:
- LS-C746951
- Additional Names:
- H2AFX, H2AX, Histone H2A.x, H2A.X, H2A histone family, member X, H2AX histone
- Application:
- Immunofluorescence, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 50 to the C-Terminus of human H2AFX (NP_002096.1). VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:772548
