TP53 / p53 Antibody
Product Sizes
100 ul
£ POA
LS-C746919-100UL
20 ul
£ POA
LS-C746919-20UL
About this Product
- SKU:
- LS-C746919
- Additional Names:
- TP53, BCC7, Cellular tumor antigen p53, p53, TRP53, p53 tumor suppressor, Phosphoprotein p53, Antigen NY-CO-13, Tumor protein p53, Tumor suppressor p53, LFS1
- Application:
- Immunofluorescence, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of mouse TP53 (NP_035770.2). SAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:772516
