AKT1 Antibody
Product Sizes
100 ul
£ POA
LS-C746867-100UL
20 ul
£ POA
LS-C746867-20UL
About this Product
- SKU:
- LS-C746867
- Additional Names:
- AKT1, AKT, AKT-1, C-AKT, Pan-AKT, PKB alpha, PKBalpha, Proto-oncogene c-Akt, Protein kinase B, Rac protein kinase alpha, PRKBA, Protein kinase B alpha, RAC-PK-alpha, PKB, PKB-ALPHA, RAC, RAC-ALPHA
- Application:
- Immunofluorescence, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 400 to the C-Terminus of human AKT1 (NP_005154.2). KEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:772464
