CCL20 / MIP-3-Alpha Antibody
Product Sizes
100 ul
£ POA
LS-C746793-100UL
20 ul
£ POA
LS-C746793-20UL
About this Product
- SKU:
- LS-C746793
- Additional Names:
- CCL20, Beta chemokine exodus-1, Beta-chemokine exodus-1, CKb4, Exodus-1, MIP-3a, MIP-3-alpha, LARC, ST38, SCYA20, C-C motif chemokine 20, CC chemokine LARC, Mip-3alpha, MIP3A, Small-inducible cytokine A20
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 1-95 of human CCL20 (NP_001123518.1). MCCTKSLLLAALMSVLLLHLCGESEASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:772390
