GJB1 / CX32 / Connexin 32 Antibody
Product Sizes
100 ug
£ POA
LS-C662687-100UG
About this Product
- SKU:
- LS-C662687
- Additional Names:
- GJB1, Connexin 32, CMTX1, Connexin-32, CX32, Gap junction beta-1 protein, Gap junction protein beta-1, CMTX
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence of human Connexin 32/GJB1 (AMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVH).
- Physical State:
- Lyophilized
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676992
