CD209 / DC-SIGN Antibody
Product Sizes
100 ug
£ POA
LS-C662685-100UG
About this Product
- SKU:
- LS-C662685
- Additional Names:
- CD209, CD209 antigen, CD209 molecule, CDSIGN, CLEC4L, DC-SIGN, HIV gpl20-binding protein, DC-SIGN1
- Application:
- Flow Cytometry, IHC-Frozen, IHC-Paraffin, Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA).
- Physical State:
- Lyophilized
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676990
