SOX10 Antibody
Product Sizes
100 ug
£ POA
LS-C662663-100UG
About this Product
- SKU:
- LS-C662663
- Additional Names:
- SOX10, DOM, Transcription factor SOX-10, WS4, PCWH, WS2E, SRY-related HMG-box gene 10, WS4C, SOX-10
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence of human SOX10 (KPHIDFGNVDIGEISHEVMSNMETFDVAELDQYL).
- Physical State:
- Lyophilized
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Expressed in fetal brain and in adult brain, heart, small intestine and colon.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676968
