ACE / CD143 Antibody
Product Sizes
100 ug
£ POA
LS-C662617-100UG
About this Product
- SKU:
- LS-C662617
- Additional Names:
- ACE, ACE1, Angiotensin-converting enzyme, CD143, CD143 antigen, Carboxycathepsin, DIPEPTIDYL CARBOXYPEPTIDASE, DCP, Dipeptidyl carboxypeptidase I, ICH, Kininase II, MVCD3, Peptidyl-dipeptidase A, Peptidase P, DCP1, Dipeptidyl carboxypeptidase 1, Testicular ECA
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence of mouse Ace (AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR).
- Physical State:
- Lyophilized
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Testis-specific isoform is expressed in spermatocytes, adult testis.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676922
