AGO2 / EIF2C2 Antibody
Product Sizes
100 ug
£ POA
LS-C662447-100UG
About this Product
- SKU:
- LS-C662447
- Additional Names:
- AGO2, Argonaute2, Argonaute 2, EIF-2C 2, EIF2C2, EIF2C 2, HAgo2, PPD, Protein slicer, Q10, PAZ Piwi domain protein, Protein argonaute-2
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Ago2/ eIF2C2 (129-169 aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676751
