BCL2L1 / BCL-XL Antibody
Product Sizes
100 ug
£ POA
LS-C662395-100UG
About this Product
- SKU:
- LS-C662395
- Additional Names:
- BCL2L1, Apoptosis regulator Bcl-X, Bcl-xL, BCL-XL/S, BCLXS, Bcl-2-like protein 1, BCL2-like 1, BCL2L, Bcl-X, Bcl-xS, BCLXL, PPP1R52, Bcl2-L-1, BCLX
- Application:
- Flow Cytometry, IHC-Frozen, Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105 aa LDAREVIPMAAVKQALREAGDEFELRYRRAF), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Bcl-X(S) is expressed at high levels in cells that undergo a high rate of turnover, such as developing lymphocytes. In contrast, Bcl-X(L) is found in tissues containing long-lived postmitotic cells, such as adult brain.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676699
