TGFBR1 / ALK5 Antibody
Product Sizes
100 ug
£ POA
LS-C662381-100UG
About this Product
- SKU:
- LS-C662381
- Additional Names:
- TGFBR1, AAT5, ACVRLK4, ALK-5, ALK5, Activin receptor-like kinase 5, LDS1A, LDS2A, MSSE, SKR4, TGF beta receptor I, TGF-beta receptor type-1, TGF-beta type I receptor, TbetaR-I, TGFR-1, TGF-beta receptor type I
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human TGFBR1 (149-186 aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Found in all tissues examined, most abundant in placenta and least abundant in brain and heart.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676685
