INSR / Insulin Receptor Antibody
Product Sizes
100 ug
£ POA
LS-C662354-100UG
About this Product
- SKU:
- LS-C662354
- Additional Names:
- INSR, CD220, ILP receptor, Insulin receptor, IR, HHF5, CD220 antigen
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Insulin Receptor (38-76 aa MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Isoform Long and isoform Short are predominantly expressed in tissue targets of insulin metabolic effects: liver, adipose tissue and skeletal muscle but are also expressed in the peripheral nerve, kidney, pulmonary alveoli, pancreatic acini, placenta vascular endothelium, fibroblasts, monocytes, granulocytes, erythrocytes and skin. Isoform Short is preferentially expressed in fetal cells such as f
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676658
