ACCN1 / ASIC2 Antibody
Product Sizes
100 ug
£ POA
LS-C662331-100UG
About this Product
- SKU:
- LS-C662331
- Additional Names:
- ASIC2, ACCN1, ASIC2a, Brain sodium channel 1, Degenerin, ACCN, Acid-sensing ion channel 2, Mammalian degenerin homolog, MDEG, MDEG1, MDEG2, HBNaC1, BNaC1, MAMMALIAN DEGENERIN, ASIC2b
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human ACCN1 (112-147 aa ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK), different from the related mouse and rat sequences by one amino acid.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Brain and spinal cord. Isoform 1 is also detected in testis, liver, colon and ovary. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676635
