FDC-SP / C4orf7 Antibody
Product Sizes
100 ug
£ POA
LS-C662282-100UG
About this Product
- SKU:
- LS-C662282
- Additional Names:
- FDCSP, C4orf7, FDC secreted protein, FDC-SP
- Application:
- IHC-Paraffin, Immunohistochemistry
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51 aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR).
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Abundantly expressed in tonsil, lymph node, and trachea; strong expression in prostate; lower expression in thyroid, stomach, and colon. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676585
