ADAM28 Antibody
Product Sizes
100 ug
£ POA
LS-C662251-100UG
About this Product
- SKU:
- LS-C662251
- Additional Names:
- ADAM28, Disintegrin 1, Dtgn1, ADAM 28, EMDCII, EMDC II, MDC-L, MDC-Ls, MDCL, MDC-Lm
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human ADAM28 (207-248 aa EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH), different from the related mouse sequence by eleven amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Expressed predominantly in secondary lymphoid tissues, such as lymph node, spleen, small intestine, stomach, colon, appendix and trachea. The lymphocyte population is responsible for expression of this protein in these tissues. Isoform 2 is expressed preferentially in spleen.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676547
