AP50 / AP2M1 Antibody
Product Sizes
100 ug
£ POA
LS-C662243-100UG
About this Product
- SKU:
- LS-C662243
- Additional Names:
- AP2M1, Adaptin-mu2, AP-2 complex subunit mu, AP-2 mu 2 chain, AP-2 mu chain, AP50, CLAPM1, Mu2, KIAA0109, HA2 50 kDa subunit
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human AP2M1 (399-435 aa LKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676536
