NARG1 / NAA15 Antibody
Product Sizes
100 ug
£ POA
LS-C662236-100UG
About this Product
- SKU:
- LS-C662236
- Additional Names:
- NAA15, Ga19, Gastric cancer antigen Ga19, Protein tubedown-1, Tubedown-1, NARG1, TBDN100, N-terminal acetyltransferase, NATH, NMDA receptor regulated 1
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human NARG1 (244-287 aa ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY), different from the related mouse sequence by one amino acid.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Expressed at high levels in testis and in ocular endothelial cells. Also found in brain (corpus callosum), heart, colon, bone marrow and at lower levels in most adult tissues, including thyroid, liver, pancreas, mammary and salivary glands, lung, ovary, urogenital system and upper gastrointestinal tract. Overexpressed in gastric cancer, in papillary thyroid carcinomas and in a Burkitt lymphoma cel
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676525
