AKR1B10 Antibody
Product Sizes
100 ug
£ POA
LS-C662177-100UG
About this Product
- SKU:
- LS-C662177
- Additional Names:
- AKR1B10, AKR1B11, Aldose reductase-like peptide, ALDRLn, AKR1B12, Aldose reductase-like, Aldose reductase-like 1, ARP, HARP, HSI, Small intestine reductase, ARL-1, SI reductase
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human AKR1B10 (285-316 aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY).
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Found in many tissues. Highly expressed in small intestine, colon and adrenal gland.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676438
