ALOX12 / 12 Lipoxygenase Antibody
Product Sizes
100 ug
£ POA
LS-C662147-100UG
About this Product
- SKU:
- LS-C662147
- Additional Names:
- ALOX12, 12S-lipoxygenase, 12-lipoxygenase, 12S-LOX, 12(S)-lipoxygenase, 12-LOX, 12 Lipoxygenase, Arachidonate 12-lipoxygenase, LOG12, Platelet 12-LOX, Platelet-type 12-lipoxygenase, Platelet-type lipoxygenase 12
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human 12 Lipoxygenase (186-231 aa ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Expressed in vascular smooth muscle cells. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676394
