CPM / Carboxypeptidase M Antibody
Product Sizes
100 ug
£ POA
LS-C662108-100UG
About this Product
- SKU:
- LS-C662108
- Additional Names:
- CPM, Carboxypeptidase M, Renal carboxypeptidase, Urinary carboxypeptidase B
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Monoclonal
- Host:
- Mouse
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human CPM (286-316 aa KYPREEKLPSFWNNNKASLIEYIKQVHLGVK), different from the related mouse sequence by two amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:676332
