HNRPA1 / HnRNP A1 Antibody
Product Sizes
100 ug
£ POA
LS-C662098-100UG
About this Product
- SKU:
- LS-C662098
- Additional Names:
- HNRNPA1, HNRPA1L3, HnRNP A1, HnRNP A1-like 3, HnRNP core protein A1, Helix-destabilizing protein, HNRPA1, HnRNP core protein A1-like 3, HnRNP-A1
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Monoclonal
- Host:
- Mouse
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human HnRNP A1 (8-42 aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:676316
