IL6R / IL6 Receptor Antibody (aa379-419)
Product Sizes
100 ug
£ POA
LS-C662095-100UG
About this Product
- SKU:
- LS-C662095
- Additional Names:
- IL6R, CD126, gp80, IL-6R subunit alpha, IL-6R-alpha, IL-6RA, IL6Q, IL-6 receptor subunit alpha, IL-6R 1, IL-6R-1, Interleukin 6 receptor, Membrane glycoprotein 80, CD126 antigen, IL6RA, IL6RQ
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human IL6R (379-419 aa LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR).
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Isoform 2 is expressed in peripheral blood mononuclear cells and weakly found in urine and serum.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676310
