ABCA4 Antibody
Product Sizes
100 ug
£ POA
LS-C662052-100UG
About this Product
- SKU:
- LS-C662052
- Additional Names:
- ABCA4, ABCR, ABC10, ARMD2, CORD3, FFM, RIM ABC transporter, RIM protein, RMP, RP19, STGD, Photoreceptor rim protein, Stargardt disease protein, STGD1
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ABCA4 (1890-1927 aa FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR), different from the related mouse sequence by eight amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Retinal-specific. Seems to be exclusively found in the rims of rod photoreceptor cells.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676238
