FUS / TLS Antibody
Product Sizes
100 ug
£ POA
LS-C662023-100UG
About this Product
- SKU:
- LS-C662023
- Additional Names:
- FUS, 75 kDa DNA-pairing protein, ALS6, CHOP, FUS-CHOP, FUS1, Fused in sarcoma, HnRNP-P2, HNRNPP2, Oncogene TLS, RNA-binding protein FUS, TLS, C/EBP-homologous protein, ETM4, Fus-like protein, Oncogene FUS, POMP75
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT).
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Ubiquitous.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676184
