CYP17 / CYP17A1 Antibody
Product Sizes
100 ug
£ POA
LS-C661998-100UG
About this Product
- SKU:
- LS-C661998
- Additional Names:
- CYP17A1, CYP17, CYPXVII, CPT7, Cytochrome P450-C17, Cytochrome P450c17, p450C17, Steroid 17-alpha-monooxygenase, Cytochrome P450 17A1, Cytochrome p450 XVIIA1, S17AH
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human CYP17A1 (383-419 aa EFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN), different from the related mouse and rat sequences by ten amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676152
