IL-1B / IL-1 Beta Antibody
Product Sizes
100 ug
£ POA
LS-C661920-100UG
About this Product
- SKU:
- LS-C661920
- Additional Names:
- IL1B, IL-1B, IL-1 beta, IL1-BETA, Preinterleukin 1 beta, Pro-interleukin-1-beta, Catabolin, IL-1, IL1F2, Interleukin 1, beta, Interleukin-1 beta
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence of mouse IL1 beta (DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE).
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Shipping Conditions:
- Ambient
- Specificity:
- Expressed in activated macrophages (at protein level).
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:676018
