PTGS2 / COX2 / COX-2 Antibody
Product Sizes
100 ug
£ POA
LS-C661918-100UG
About this Product
- SKU:
- LS-C661918
- Additional Names:
- PTGS2, COX-2, Cyclooxygenase-2, COX2, Cyclooxygenase 2b, HCox-2, GRIPGHS, PGH synthase 2, PGHS-2, PHS II, PHS-2, Prostaglandin H2 synthase 2, PGG/HS, Prostaglandin G/H synthase 2
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Monoclonal
- Host:
- Mouse
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human PTGS2 (365-397 aa AEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNN), different from the related mouse and rat sequences by eight amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:676015
