EGFR Antibody
Product Sizes
100 ug
£ POA
LS-C661904-100UG
About this Product
- SKU:
- LS-C661904
- Additional Names:
- EGFR, EGF Receptor, ERBB, ERBB1, MENA, PIG61, Proto-oncogene c-ErbB-1, V-erb-b homolog, EGF-R, HER1
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Monoclonal
- Host:
- Mouse
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human EGFR (25-57 aa LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNN), different from the related mouse sequence by two amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Ubiquitously expressed. Isoform 2 is also expressed in ovarian cancers. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:675996
