CD119 / IFNGR1 Antibody
Product Sizes
100 ug
£ POA
LS-C661879-100UG
About this Product
- SKU:
- LS-C661879
- Additional Names:
- IFNGR1, AVP, type 2, Antiviral protein, type 2, CD119, CD119 antigen, IFNGR, IFN-gamma receptor 1, IFN-gamma-R1, Immune interferon receptor 1, Interferon gamma receptor 1, CDw119
- Application:
- Flow Cytometry, Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human IFNGR1 (443-484 aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:675970
