ACTN3 Antibody
Product Sizes
100 ug
£ POA
LS-C661871-100UG
About this Product
- SKU:
- LS-C661871
- Additional Names:
- ACTN3, Actinin, alpha 3, Alpha-actinin skeletal muscle, Alpha-actinin-3, F-actin cross-linking protein
- Application:
- Flow Cytometry, IHC-Paraffin, Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ACTN3 (574-617 aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Expressed only in a subset of type 2 skeletal muscle fibers. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:675958
