STAT3 Antibody (HRP)
Product Sizes
100 ul
£ POA
LS-C549621-100UL
About this Product
- SKU:
- LS-C549621
- Additional Names:
- STAT3, Acute-phase response factor, APRF, DNA-binding protein APRF, HIES
- Application:
- Immunocytochemistry, Immunoprecipitation, Western Blot
- Buffer:
- PBS, pH 7.2, No preservatives added
- Clonality:
- Polyclonal
- Conjugate:
- HRP
- Host:
- Rabbit
- Immunogen:
- Bacterially expressed GST fusion protein corresponding to human STAT3 (aa 688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 aa are identical to mouse STAT3B.
- Isotype:
- IgG
- Purification:
- Protein A Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Recognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species cross-reactivity: Human, rat and mouse.
- Storage Conditions:
- 2-8[o]C
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:563183
