TSG101 Antibody
Product Sizes
100 ul
£ POA
LS-C497922-100UL
20 ul
£ POA
LS-C497922-20UL
About this Product
- SKU:
- LS-C497922
- Additional Names:
- TSG101, ESCRT-I complex subunit TSG101, Tumor susceptibility gene 10, Tumor susceptibility protein, VPS23, Tumor susceptibility gene 101, TSG10
- Application:
- Immunohistochemistry, Immunoprecipitation, Western Blot
- Buffer:
- PBS with 0.09% Sodium azide,50% glycerol,pH7.3
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of human TSG101 (NP_006283.1). SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:511239
