GPR49 / LGR5 Antibody
Product Sizes
100 ul
£ POA
LS-C497256-100UL
20 ul
£ POA
LS-C497256-20UL
About this Product
- SKU:
- LS-C497256
- Additional Names:
- LGR5, FEX, G-protein coupled receptor 49, G protein-coupled receptor 49, GPR67, GRP49, GPR49, HG38, G-protein coupled receptor 67
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 824-907 of human LGR5 (NP_003658.1). NPHFKEDLVSLRKQTYVWTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:510573
