REEP5 Antibody
Product Sizes
100 ul
£ POA
LS-C497098-100UL
20 ul
£ POA
LS-C497098-20UL
About this Product
- SKU:
- LS-C497098
- Additional Names:
- REEP5, C5orf18, D5S346, Deleted in polyposis 1, Deleted in polyposis, Polyposis locus protein 1, Protein TB2, Receptor accessory protein 5, TB2, YOP1, DP1
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 120-189 of human REEP5 (NP_005660.4). FLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:510415
