BAGE2 Antibody
Product Sizes
100 ul
£ POA
LS-C496870-100UL
20 ul
£ POA
LS-C496870-20UL
About this Product
- SKU:
- LS-C496870
- Additional Names:
- BAGE2, B melanoma antigen 2, Cancer/testis antigen 2.2, CT2.2
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 18-109 of human BAGE2 (NP_872288.2). RLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPRCIIILVLQEPTPFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATARETS
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:510187
